PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.SF01D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 688aa    MW: 75625.8 Da    PI: 5.5881
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.SF01DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.1e-29207260155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Araip.SF01D 207 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 260
                  79*******************.********************************8 PP

2Response_reg83.95e-28211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++h++ +++ + +  Ga 
   Araip.SF01D  21 VLAVDDDPTCLKVLENLLRKCQY-QVTTTNQAIEALRMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSGHSDTKLVMKGVTHGAV 115
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   Araip.SF01D 116 DYLLKPVRIEELKN 129
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.7E-1645688IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.0E-4318153No hitNo description
SuperFamilySSF521725.41E-3718140IPR011006CheY-like superfamily
SMARTSM004481.7E-3419131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.73920135IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.7E-2521129IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.20E-3022134No hitNo description
Gene3DG3DSA:1.10.10.601.7E-30204264IPR009057Homeodomain-like
PROSITE profilePS5129412.169204263IPR017930Myb domain
SuperFamilySSF466895.73E-20205264IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-25207260IPR006447Myb domain, plants
PfamPF002491.2E-7209259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
QRWLKMTVED QIDRFPVGMR VLAVDDDPTC LKVLENLLRK CQYQVTTTNQ AIEALRMLRE  60
NRNKFDLVIS DVNMPDMDGF KLLELVGLEM DLPVIMLSGH SDTKLVMKGV THGAVDYLLK  120
PVRIEELKNI WQHVVRRKNF DPRDQNKGSN DKRGPNAAGE GNQSIISEDG SDQNKNLGKK  180
RKDQTEEEED DGEDNGEDND DPSSQKKPRV VWSVELHRKF VAAVNQLGLD KAVPKKILDL  240
MNVEGLTREN VASHLQKYRL YLKKATQQAS MVAALGNTES YLRIGSIDAY AEFCTSSGSG  300
KIPNPALQSY ASSGIFGRLN SPASLSMRGI SASTLIQPPV QPQNLNSTLS PLGNIQASIF  360
PANQTSSLLQ GIPTSIELNQ SKQNNCTTGI TQVNQVSCSG FTAASGFRDR RLTVGTASNA  420
LPSAACNSPQ THNSGAFRNQ PPVRPASLGT DSFDAGICGP SNMLDYNRCN ENWQNAEQLS  480
KLPANPLPLC EPFNNDPLPP TGINVANTST RIGNSPVDYS SRVAISVPLE DTRNELQRQE  540
GLIENIVQPS SYTTPSQRWE EHKLEYSQNM SRPFNSVNSH VSSSRVTSSL GHNLNQTNAT  600
CSNSVDASFV GQLSGAPPSI IQCTNVDTRL KSNDAYILEL MKSRDGFIQN NFGTLDDIMV  660
PMVKREQNEP TFIDGEMGFE AYPVGSCI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25203266164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016188779.10.0PREDICTED: two-component response regulator ARR12-like isoform X2
SwissprotQ6K8X61e-137ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0B2P7U30.0A0A0B2P7U3_GLYSO; Two-component response regulator ARR12
TrEMBLI1L2E20.0I1L2E2_SOYBN; Uncharacterized protein
STRINGGLYMA09G14650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-129response regulator 12